Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein
CAT#: TP324622
Recombinant protein of human clathrin, light chain (Lcb) (CLTB), transcript variant 2, 20 µg
View other "Clathrin light chain" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224622 representing NM_007097
Red=Cloning site Green=Tags(s) MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK DVSRLRSVLMSLKQTPLSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009028 |
Locus ID | 1212 |
UniProt ID | P09497 |
Refseq Size | 1184 |
Cytogenetics | 5q35.2 |
Refseq ORF | 687 |
Synonyms | LCB |
Summary | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis, Huntington's disease, Lysosome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Role of flotillins in the endocytosis of GPCR in salivary gland epithelial cells.
,null,
Biochemical and biophysical research communications
,PubMed ID 27221048
[CLTB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400697 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416210 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400697 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 1 |
CNY 3,080.00 |
|
LY416210 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 2 |
CNY 3,080.00 |
|
PH324622 | CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028) |
CNY 19,520.00 |
其它Clathrin light chain产品