NT5C1A (NM_032526) Human Recombinant Protein
CAT#: TP324617
Purified recombinant protein of Homo sapiens 5'-nucleotidase, cytosolic IA (NT5C1A), 20 µg
View other "NT5C1A" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 4 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224617 representing NM_032526
Red=Cloning site Green=Tags(s) MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQI YTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINS INHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVVVSQSQLRVAF DGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLV TARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG VAQTPRRTAPAKQAPSAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115915 |
Locus ID | 84618 |
UniProt ID | Q9BXI3 |
Refseq Size | 1107 |
Cytogenetics | 1p34.2 |
Refseq ORF | 1104 |
Synonyms | CN-I; CN-IA; CN1; CN1A; CNI |
Summary | Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates (Hunsucker et al., 2001 [PubMed 11133996]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
Glycolytic flux control by drugging phosphoglycolate phosphatase
,null,
Nature Communications
,PubMed ID 36369173
[NT5C1A]
|
Anti-cN-1A autoantibodies are absent in juvenile dermatomyositis
,Rietveld, A;Wienke, J;Visser, E;Vree Egberts, W;Schlumberger, W;van Engelen, B;van Royen-Kerkhof, A;Lu, H;Wedderburn, L;Saris, C;Tansley, S;Pruijn, G;Juvenile Dermatomyositis Research Group, ;,
Arthritis & rheumatology (Hoboken, N.J.) 2021
,PubMed ID 33497020
[NT5C1A]
|
HLA-DRB1 allele and autoantibody profiles in Japanese patients with inclusion body myositis
,Oyama, M;Ohnuki, Y;Inoue, M;Uruha, A;Yamashita, S;Yutani, S;Tanboon, J;Nakahara, J;Suzuki, S;Shiina, T;Nishino, I;Suzuki, S;,
PLoS ONE
,PubMed ID 32810190
[NT5C1A]
|
Anti-NT5c1A Autoantibodies as Biomarkers in Inclusion Body Myositis
,Amlani, A;Choi, MY;Tarnopolsky, M;Brady, L;Clarke, AE;Garcia-De La Torre, I;Mahler, M;Schmeling, H;Barber, CE;Jung, M;Fritzler, MJ;,
Front Immunol
,PubMed ID 31024569
[NT5C1A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH324617 | NT5C1A MS Standard C13 and N15-labeled recombinant protein (NP_115915) |
CNY 14,250.00 |