VSTM1 (NM_198481) Human Recombinant Protein
CAT#: TP324612
Recombinant protein of human V-set and transmembrane domain containing 1 (VSTM1), 20 µg
View other "VSTM1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224612 representing NM_198481
Red=Cloning site Green=Tags(s) MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQ EQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI FSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPEXEAAEADLSNMERVSLSTADPQGVTYAELS TSALSEAASDTTQEPPGSHEYAALKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_940883 |
Locus ID | 284415 |
UniProt ID | Q6UX27 |
Refseq Size | 1024 |
Cytogenetics | 19q13.42 |
Refseq ORF | 708 |
Synonyms | SIRL-1; SIRL1; UNQ3033 |
Summary | Isoform 2: Behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404915 | VSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404915 | Transient overexpression lysate of V-set and transmembrane domain containing 1 (VSTM1) |
CNY 3,080.00 |
|
PH324612 | VSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_940883) |
CNY 19,520.00 |