Mammaglobin A (SCGB2A2) (NM_002411) Human Recombinant Protein
CAT#: TP324550
Recombinant protein of human secretoglobin, family 2A, member 2 (SCGB2A2), 20 µg
View other "Mammaglobin A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224550 protein sequence
Red=Cloning site Green=Tags(s) MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQT DETLSNVEVFMQLIYDSSLCDLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002402 |
Locus ID | 4250 |
UniProt ID | Q13296 |
Refseq Size | 517 |
Cytogenetics | 11q12.3 |
Refseq ORF | 279 |
Synonyms | MGB1; PSBP1; UGB2 |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Nanoscale flow cytometry for immunophenotyping and quantitating extracellular vesicles in blood plasma
,Salmond, N;Khanna, K;Owen, GR;Williams, KC;,
Nanoscale
,PubMed ID 33449064
[SCGB2A2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419345 | SCGB2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419345 | Transient overexpression lysate of secretoglobin, family 2A, member 2 (SCGB2A2) |
CNY 3,080.00 |
|
PH324550 | SCGB2A2 MS Standard C13 and N15-labeled recombinant protein (NP_002402) |
CNY 19,520.00 |
其它Mammaglobin A产品