VRK3 (NM_016440) Human Recombinant Protein
CAT#: TP324292
Recombinant protein of human vaccinia related kinase 3 (VRK3), transcript variant 1, 20 µg
View other "VRK3" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224292 protein sequence
Red=Cloning site Green=Tags(s) MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVT SPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGR LFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSE RSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057524 |
Locus ID | 51231 |
UniProt ID | Q8IV63 |
Refseq Size | 2129 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1422 |
Summary | This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414023 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422459 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425502 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414023 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 1 |
CNY 4,840.00 |
|
LY422459 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 |
CNY 4,840.00 |
|
LY425502 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 |
CNY 3,080.00 |
|
PH324292 | VRK3 MS Standard C13 and N15-labeled recombinant protein (NP_057524) |
CNY 19,520.00 |
|
TP761240 | Purified recombinant protein of Human vaccinia related kinase 3 (VRK3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |