United States
Germany
Japan
United Kingdom
China
VRK3 (NM_016440) Human Mass Spec Standard
CAT＃: PH324292
VRK3 MS Standard C13 and N15-labeled recombinant protein (NP_057524)
View other "VRK3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | VRK3 MS Standard C13 and N15-labeled recombinant protein (NP_057524) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224292 |
| Predicted MW | 52.9 kDa |
| Protein Sequence |
>RC224292 protein sequence
Red=Cloning site Green=Tags(s) MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVT SPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGR LFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSE RSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057524 |
| RefSeq Size | 2129 |
| RefSeq ORF | 1422 |
| Locus ID | 51231 |
| Cytogenetics | 19q13.33 |
| Summary | This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414023 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422459 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC425502 | VRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414023 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 1 |
CNY 4,840.00 |
|
| LY422459 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 |
CNY 4,840.00 |
|
| LY425502 | Transient overexpression lysate of vaccinia related kinase 3 (VRK3), transcript variant 2 |
CNY 3,080.00 |
|
| TP324292 | Recombinant protein of human vaccinia related kinase 3 (VRK3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP761240 | Purified recombinant protein of Human vaccinia related kinase 3 (VRK3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
