DIABLO (NM_138929) Human Recombinant Protein
CAT#: TP324190
Recombinant protein of human diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg
View other "DIABLO" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224190 representing NM_138929
Red=Cloning site Green=Tags(s) MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQAVYTLTSLY RQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITAR NHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620307 |
Locus ID | 56616 |
UniProt ID | Q9NR28 |
Refseq Size | 1366 |
Cytogenetics | 12q24.31 |
Refseq ORF | 585 |
Synonyms | DFNA64; DIABLO-S; SMAC; SMAC3 |
Summary | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408473 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412673 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429603 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408473 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY412673 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
PH324145 | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308) |
CNY 14,250.00 |
|
PH324190 | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620307) |
CNY 19,520.00 |
|
TP324145 | Purified recombinant protein of Homo sapiens diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |