CADM3 (NM_021189) Human Recombinant Protein
CAT#: TP324162
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 1, 20 µg
View other "CADM3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224162 representing NM_021189
Red=Cloning site Green=Tags(s) MGAPAASLLLLLLLFACCWAPGGANLSQDGYWQEQDLELGTLAPLDEAISSTVWSSPDMLASQDSQPWTS DETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEG EYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEP TRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNV NDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGG QSGGDDKKEYFI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067012 |
Locus ID | 57863 |
UniProt ID | Q8N126 |
Refseq Size | 2540 |
Cytogenetics | 1q23.2 |
Refseq ORF | 1296 |
Synonyms | BIgR; IGSF4B; Necl-1; NECL1; synCAM3; TSLL1 |
Summary | The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is reported to be a tumor suppressor gene. [provided by RefSeq, Oct 2016] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412028 | CADM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY412028 | Transient overexpression lysate of cell adhesion molecule 3 (CADM3), transcript variant 1 |
CNY 4,840.00 |
|
PH324162 | CADM3 MS Standard C13 and N15-labeled recombinant protein (NP_067012) |
CNY 14,250.00 |
|
TP720367 | Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2 |
CNY 3,140.00 |