PD L2 (PDCD1LG2) (NM_025239) Human Recombinant Protein
CAT#: TP324141
Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 20 µg
View other "PD L2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079515 |
Locus ID | 80380 |
UniProt ID | Q9BQ51 |
Refseq Size | 1518 |
Cytogenetics | 9p24.1 |
Refseq ORF | 819 |
Synonyms | B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2 |
Summary | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410802 | PDCD1LG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY410802 | Transient overexpression lysate of programmed cell death 1 ligand 2 (PDCD1LG2) |
CN¥ 3,080.00 |
|
PH324141 | PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515) |
CN¥ 19,520.00 |
|
TP700202 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain expressed in human cells, 20 µg |
CN¥ 6,650.00 |
|
TP700203 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
CN¥ 6,650.00 |
|
TP720737 | Purified recombinant protein of Human programmed cell death 1 ligand 2 (PDCD1LG2) |
CN¥ 1,800.00 |