C4orf44 (MSANTD1) (NM_001042690) Human Recombinant Protein

CAT#: TP324127

Recombinant protein of human chromosome 4 open reading frame 44 (C4orf44), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "C4orf44" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (3)
Rabbit Polyclonal Anti-MSANTD1 Antibody
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC224127 representing NM_001042690
Red=Cloning site Green=Tags(s)

MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKR
NAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCD
GKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKV
QSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREVRRVLDQQHILQVQSLQLQERMMSLLERIITKSSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001036155
Locus ID 345222
UniProt ID Q6ZTZ1
Refseq Size 1670
Cytogenetics 4p16.3
Refseq ORF 834
Synonyms C4orf44
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...