BTN1A1 (NM_001732) Human Recombinant Protein
CAT#: TP323852
Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1), 20 µg
View other "BTN1A1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223852 representing NM_001732
Red=Cloning site Green=Tags(s) MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD TSTKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD LSKEIPLSPMGEESAPRDADTLHSKLIPTQPSQGAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001723 |
Locus ID | 696 |
UniProt ID | Q13410, Q4VAN2 |
Refseq Size | 2901 |
Cytogenetics | 6p22.2 |
Refseq ORF | 1578 |
Synonyms | BT; BTN; BTN1 |
Summary | Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400653 | BTN1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400653 | Transient overexpression lysate of butyrophilin, subfamily 1, member A1 (BTN1A1) |
CNY 4,840.00 |
|
PH323852 | BTN1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001723) |
CNY 19,520.00 |
|
TP720427 | Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1) |
CNY 3,140.00 |