Histone H2A Bbd (H2AFB2) (NM_001017991) Human Recombinant Protein
CAT#: TP323551
Recombinant protein of human H2A histone family, member B2 (H2AFB2), 20 µg
View other "Histone H2A Bbd" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223551 protein sequence
Red=Cloning site Green=Tags(s) MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017991 |
Locus ID | 474381 |
UniProt ID | P0C5Z0 |
Refseq Size | 594 |
Cytogenetics | Xq28 |
Refseq ORF | 345 |
Synonyms | H2A.Bbd; H2AB3; H2AFB2 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422230 | H2AFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422230 | Transient overexpression lysate of H2A histone family, member B2 (H2AFB2) |
CN¥ 3,080.00 |
|
PH323551 | H2AFB2 MS Standard C13 and N15-labeled recombinant protein (NP_001017991) |
CN¥ 19,520.00 |
其它Histone H2A Bbd产品