ketohexokinase (KHK) (NM_006488) Human Recombinant Protein
CAT#: TP323488
Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b, 20 µg
View other "ketohexokinase" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223488 representing NM_006488
Red=Cloning site Green=Tags(s) MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVAD FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEG RNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRF GCQVAGKKCGLQGFDGIV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006479 |
Locus ID | 3795 |
UniProt ID | P50053 |
Refseq Size | 1899 |
Cytogenetics | 2p23.3 |
Refseq ORF | 894 |
Summary | This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A luminescence-based protocol for assessing fructose metabolism via quantification of ketohexokinase enzymatic activity in mouse or human hepatocytes
,null,
STAR Protocols
,PubMed ID 34409309
[KHK]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400082 | KHK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416608 | KHK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400082 | Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant a |
CNY 3,080.00 |
|
LY416608 | Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant b |
CNY 3,080.00 |
|
PH302424 | KHK MS Standard C13 and N15-labeled recombinant protein (NP_000212) |
CNY 19,520.00 |
|
PH323488 | KHK MS Standard C13 and N15-labeled recombinant protein (NP_006479) |
CNY 19,520.00 |
|
TP302424 | Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant a, 20 µg |
CNY 2,900.00 |
|
TP721095 | Purified recombinant protein of Human ketohexokinase (fructokinase) (KHK), transcript variant a |
CNY 4,360.00 |
其它ketohexokinase产品