UGT2B10 (NM_001075) Human Recombinant Protein
CAT#: TP323408
Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1, 20 µg
View other "UGT2B10" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223408 representing NM_001075
Red=Cloning site Green=Tags(s) MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ ESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERV KNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLH CKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNT RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSL DVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001066 |
Locus ID | 7365 |
UniProt ID | P36537 |
Refseq Size | 1620 |
Cytogenetics | 4q13.2 |
Refseq ORF | 1584 |
Synonyms | UDPGT2B10 |
Summary | UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421349 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428511 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421349 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 |
CNY 4,840.00 |
|
LY428511 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2 |
CNY 3,080.00 |
|
PH323408 | UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001066) |
CNY 19,520.00 |
|
PH327991 | UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239) |
CNY 19,520.00 |
|
TP327991 | Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它UGT2B10产品