DAP3 (NM_033657) Human Recombinant Protein
CAT#: TP323182
Recombinant protein of human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "DAP3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223182 representing NM_033657
Red=Cloning site Green=Tags(s) MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_387506 |
Locus ID | 7818 |
UniProt ID | P51398 |
Refseq Size | 1650 |
Cytogenetics | 1q22 |
Refseq ORF | 1194 |
Synonyms | bMRP-10; DAP-3; MRP-S29; MRPS29; S29mt |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403256 | DAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417860 | DAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403256 | Transient overexpression lysate of death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY417860 | Transient overexpression lysate of death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
PH323182 | DAP3 MS Standard C13 and N15-labeled recombinant protein (NP_387506) |
CNY 19,520.00 |