Pirin (PIR) (NM_003662) Human Recombinant Protein
CAT#: TP323111
Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 1, 20 µg
View other "Pirin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223111 representing NM_003662
Red=Cloning site Green=Tags(s) MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER AKTWKSKIGN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003653 |
Locus ID | 8544 |
UniProt ID | O00625 |
Refseq Size | 1316 |
Cytogenetics | Xp22.2 |
Refseq ORF | 870 |
Summary | This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401212 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422656 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401212 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 1 |
CN¥ 3,080.00 |
|
LY422656 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 2 |
CN¥ 3,080.00 |
|
PH300626 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119) |
CN¥ 19,520.00 |
|
PH323111 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653) |
CN¥ 19,520.00 |
|
TP300626 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, 20 µg |
CN¥ 2,900.00 |