kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein
CAT#: TP322594
Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 20 µg
View other "kynurenine 3 monooxygenase" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222594 representing NM_003679
Red=Cloning site Green=Tags(s) MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK VINKGLFFLGSLIAISSTYLLIHYMSPRSFLCLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.6 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | The specific activity of KMO was determined by measuring the product 3-hydroxykynurenine formation from a conversion of Kynurenine. The reaction was carried out at 37 ? for 40min in the buffer containing 100 mM Tris, pH8.0, 10 mM KCl, 1 mM NADPH, 3 mM glucose-6-phos-phate, 1 units/ml of glucose-6 phosphate dehydrogenase, and 100 ?M kynurenine as the substrate Surface Plasmon Ressonance (SPR) (PMID: 26292018) |
Reference Data | |
RefSeq | NP_003670 |
Locus ID | 8564 |
UniProt ID | O15229 |
Refseq Size | 4992 |
Cytogenetics | 1q43 |
Refseq ORF | 1458 |
Synonyms | dJ317G22.1 |
Summary | This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Kynurenine 3-Monooxygenase Interacts with Huntingtin at the Outer Mitochondrial Membrane
,null,
Biomedicines
,PubMed ID 36140394
[KMO]
|
Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition
,Mimasu, S;Yamagishi, H;Kubo, S;Kiyohara, M;Matsuda, T;Yahata, T;Thomson, HA;Hupp, CD;Liu, J;Okuda, T;Kakefuda, K;,
Communications biology
,PubMed ID 33542467
[KMO]
|
Development of a Surface Plasmon Resonance Assay for the Characterization of Small-Molecule Binding Kinetics and Mechanism of Binding to Kynurenine 3-Monooxygenase
,Poda, SB;Kobayashi, M;Nachane, R;Menon, V;Gandhi, AS;Budac, DP;Li, G;Campbell, BM;Tagmose, L;,
Assay Drug Dev Technol
,PubMed ID 26292018
[KMO]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401216 | KMO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401216 | Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO) |
CNY 4,840.00 |
|
PH322594 | KMO MS Standard C13 and N15-labeled recombinant protein (NP_003670) |
CNY 19,520.00 |
|
TP700071 | Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with C-terminal AVI tag (GGGLNDIFEAQKIEWHE) prior to MYC/DDK tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
TP700072 | Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with N-terminal AVI tag (MSGLNDIFEAQKIEWHEAIA) and C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
TP710125 | Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它kynurenine 3 monooxygenase产品