MSMP (NM_001044264) Human Recombinant Protein
CAT#: TP322527
Recombinant protein of human microseminoprotein, prostate associated (MSMP), 20 µg
View other "MSMP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s) MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 29059175) |
Reference Data | |
RefSeq | NP_001037729 |
Locus ID | 692094 |
UniProt ID | Q1L6U9 |
Refseq Size | 672 |
Cytogenetics | 9p13.3 |
Refseq ORF | 417 |
Synonyms | PSMP |
Summary | This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Induction of anti-VEGF therapy resistance by upregulated expression of microseminoprotein (MSMP)
,Mitamura, T;Pradeep, S;McGuire, M;Wu, SY;Ma, S;Hatakeyama, H;Lyons, YA;Hisamatsu, T;Noh, K;Villar-Prados, A;Chen, X;Ivan, C;Rodriguez-Aguayo, C;Hu, W;Lopez-Berestein, G;Coleman, RL;Sood, AK;,
Oncogene
,PubMed ID 29059175
[MSMP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420820 | MSMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420820 | Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) |
CNY 3,080.00 |
|
PH322527 | MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729) |
CNY 19,520.00 |