ANKRD16 (NM_001009942) Human Recombinant Protein
CAT#: TP322437
Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg
View other "ANKRD16" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222437 representing NM_001009942
Red=Cloning site Green=Tags(s) MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGHTSTIQTLLSLGADINSKDEKNRSALHLAC AGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009942 |
Locus ID | 54522 |
UniProt ID | Q6P6B7 |
Refseq Size | 1069 |
Cytogenetics | 10p15.1 |
Refseq ORF | 978 |
Synonyms | ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872 |
Summary | Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412786 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423159 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423160 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423161 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412786 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 |
CNY 3,080.00 |
|
LY423159 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 |
CNY 3,080.00 |
|
LY423160 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 |
CNY 3,080.00 |
|
LY423161 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 |
CNY 3,080.00 |
|
PH309157 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919) |
CNY 14,250.00 |
|
PH315131 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) |
CNY 14,250.00 |
|
PH322437 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) |
CNY 14,250.00 |
|
TP309157 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315131 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它ANKRD16产品