ANKRD16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ANKRD16 antibody is: synthetic peptide directed towards the N-terminal region of Human ANKRD16. Synthetic peptide located within the following region: CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	ankyrin repeat domain 16
Database Link	NP_061919 Entrez Gene 54522 Human UniProt ID Q6P6B7
Background	The function of this protein remains unknown.
Synonyms	ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872
Note	Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.