CDK10 (NM_052988) Human Recombinant Protein
CAT#: TP322310
Recombinant protein of human cyclin-dependent kinase 10 (CDK10), transcript variant a, 20 µg
View other "CDK10" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222310 representing NM_052988
Red=Cloning site Green=Tags(s) MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT SEGQSKRCKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443714 |
Locus ID | 8558 |
UniProt ID | Q15131 |
Refseq Size | 1803 |
Cytogenetics | 16q24.3 |
Refseq ORF | 1080 |
Synonyms | ALSAS; PISSLRE |
Summary | The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409344 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409345 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409344 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant b |
CNY 3,080.00 |
|
LY409345 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant a |
CNY 3,080.00 |
|
PH322310 | CDK10 MS Standard C13 and N15-labeled recombinant protein (NP_443714) |
CNY 19,520.00 |