Calpastatin (CAST) (NM_173061) Human Recombinant Protein
CAT#: TP322278
Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg
View other "Calpastatin" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222278 representing NM_173061
Red=Cloning site Green=Tags(s) MGQFLSSTFLEGSPATVWHDKLCDGERRGAREAVRIFQDQAKAKEEKLEKCGEDDETIPSEYRLKPATDK DGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQS APPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVK DKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPP RDTSSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQD KPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKT TEETSKPKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775084 |
Locus ID | 831 |
UniProt ID | P20810 |
Refseq Size | 1889 |
Cytogenetics | 5q15 |
Refseq ORF | 1290 |
Synonyms | BS-17; calpain inhibitor; calpastatin; heart-type calpastatin; MGC9402; OTTHUMP00000158519; OTTHUMP00000158520; sperm BS-17 component |
Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
CNY 4,840.00 |
|
LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
CNY 4,840.00 |
|
LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
CNY 3,080.00 |
|
LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
CNY 4,840.00 |
|
PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
CNY 19,520.00 |
|
PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
CNY 19,520.00 |
|
PH322278 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) |
CNY 14,250.00 |
|
TP302168 | Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg |
CNY 2,900.00 |
|
TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Calpastatin产品