FBXO36 (NM_174899) Human Recombinant Protein
CAT#: TP322177
Purified recombinant protein of Homo sapiens F-box protein 36 (FBXO36), 20 µg
View other "FBXO36" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222177 representing NM_174899
Red=Cloning site Green=Tags(s) MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQ TALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQS TCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_777559 |
Locus ID | 130888 |
UniProt ID | Q8NEA4 |
Refseq Size | 924 |
Cytogenetics | 2q36.3 |
Refseq ORF | 564 |
Synonyms | Fbx36 |
Summary | Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406384 | FBXO36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406384 | Transient overexpression lysate of F-box protein 36 (FBXO36) |
CNY 3,080.00 |
|
PH322177 | FBXO36 MS Standard C13 and N15-labeled recombinant protein (NP_777559) |
CNY 14,250.00 |