FBXO36 (NM_174899) Human Mass Spec Standard
CAT#: PH322177
FBXO36 MS Standard C13 and N15-labeled recombinant protein (NP_777559)
View other "FBXO36" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | FBXO36 MS Standard C13 and N15-labeled recombinant protein (NP_777559) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222177 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC222177 representing NM_174899
Red=Cloning site Green=Tags(s) MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQ TALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQS TCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_777559 |
RefSeq Size | 924 |
RefSeq ORF | 564 |
Synonyms | Fbx36 |
Locus ID | 130888 |
Cytogenetics | 2q36.3 |
Summary | Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406384 | FBXO36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406384 | Transient overexpression lysate of F-box protein 36 (FBXO36) |
CNY 3,080.00 |
|
TP322177 | Purified recombinant protein of Homo sapiens F-box protein 36 (FBXO36), 20 µg |
CNY 2,900.00 |