United States
Germany
Japan
United Kingdom
China
ARL13B (NM_182896) Human Recombinant Protein
CAT＃: TP321949
Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg
View other "ARL13B" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221949 representing NM_182896
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIF DLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGE ADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRA LEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKM EKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKK LRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPN SDAHDVIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_878899 |
| Locus ID | 200894 |
| UniProt ID | Q3SXY8 |
| Refseq Size | 3451 |
| Cytogenetics | 3q11.1-q11.2 |
| Refseq ORF | 1284 |
| Synonyms | ARL2L1; JBTS8 |
| Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
CNY 4,840.00 |
|
| LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
CNY 3,080.00 |
|
| LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 |
CNY 3,080.00 |
|
| PH310490 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433) |
CNY 19,520.00 |
|
| PH321949 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) |
CNY 19,520.00 |
|
| TP310490 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg |
CNY 2,900.00 |
