MASP1 (NM_139125) Human Recombinant Protein
CAT#: TP321839
Recombinant protein of human mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 2, 20 µg
View other "MASP1" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221839 protein sequence
Red=Cloning site Green=Tags(s) MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESS YLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDV DECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSS ECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFH SDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECL KDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW MNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSAS WILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQ EPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAEC KTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGV YTKVSNYVDWVWEQMGLPQSVVEPQVER myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_624302 |
Locus ID | 5648 |
UniProt ID | P48740 |
Refseq Size | 4184 |
Cytogenetics | 3q27.3 |
Refseq ORF | 2184 |
Synonyms | 3MC1; CRARF; CRARF1; MAP-1; MAP1; MAp44; MASP; MASP-3; MASP3; PRSS5; RaRF |
Summary | This gene encodes a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The encoded protein is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. The encoded protein is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400702 | MASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408424 | MASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422206 | MASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400702 | Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 1 |
CNY 4,840.00 |
|
LY408424 | Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 2 |
CNY 4,840.00 |
|
LY422206 | Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 3 |
CNY 3,080.00 |
|
PH319651 | MASP1 MS Standard C13 and N15-labeled recombinant protein (NP_001870) |
CNY 19,520.00 |
|
PH321839 | MASP1 MS Standard C13 and N15-labeled recombinant protein (NP_624302) |
CNY 19,520.00 |
|
TP319651 | Recombinant protein of human mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720704 | Purified recombinant protein of Human mannan-binding lectin serine peptidase 1 (MASP1) |
CNY 3,140.00 |