beta Arrestin 1 (ARRB1) (NM_020251) Human Recombinant Protein
CAT#: TP321737
Purified recombinant protein of Homo sapiens arrestin, beta 1 (ARRB1), transcript variant 2, 20 µg
View other "beta Arrestin 1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221737 representing NM_020251
Red=Cloning site Green=Tags(s) MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDV LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKAC GVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYH GEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKE EPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064647 |
Locus ID | 408 |
UniProt ID | P49407 |
Refseq Size | 2180 |
Cytogenetics | 11q13.4 |
Refseq ORF | 1230 |
Synonyms | ARB1; ARR1 |
Summary | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Endocytosis, MAPK signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Methods to Determine Interaction Interfaces Between β-Arrestins and Their Protein Partners
,Bourquard, T;Musnier, A;Tréfier, A;Landomiel, F;Boulo, T;Reiter, E;Crépieux, P;Poupon, A;,
Methods Mol. Biol.
,PubMed ID 30919355
[ARRB1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412547 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418298 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429613 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY412547 | Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY418298 | Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH321737 | ARRB1 MS Standard C13 and N15-labeled recombinant protein (NP_064647) |
CN¥ 14,250.00 |
|
TP720083 | Recombinant protein of human arrestin, beta 1 (ARRB1), transcript variant 1 |
CN¥ 1,800.00 |
|
TP762120 | Purified recombinant protein of Human arrestin, beta 1 (ARRB1), transcript variant 1,full length, with N-terminal His tag, expressed in E. coli, 50ug |
CN¥ 1,948.00 |
其它beta Arrestin 1产品