CRAT (NM_004003) Human Recombinant Protein
CAT#: TP321625
Recombinant protein of human carnitine acetyltransferase (CRAT), transcript variant 2, 20 µg
View other "CRAT" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221625 representing NM_004003
Red=Cloning site Green=Tags(s) MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRA RKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVE YLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFV QLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYR SHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSP MVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAY YRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAI RGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPM EAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003994 |
Locus ID | 1384 |
UniProt ID | P43155 |
Refseq Size | 2600 |
Cytogenetics | 9q34.11 |
Refseq ORF | 1815 |
Synonyms | CAT; CAT1; NBIA8 |
Summary | This gene encodes carnitine O-acetyltransferase, a member of the carnitine acyltransferase family and a key metabolic pathway enzyme which plays an important role in energy homeostasis and fat metabolism. This enzyme catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acyl-CoA/CoA. It is found in both the mitochondria and the peroxisome. Alternative splicing results in transcript variants encoding different isoforms that may localize to different subcellular compartments. [provided by RefSeq, Oct 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400255 | CRAT HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC418259 | CRAT HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY400255 | Transient overexpression lysate of carnitine acetyltransferase (CRAT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CN¥ 4,840.00 |
|
LY418259 | Transient overexpression lysate of carnitine acetyltransferase (CRAT), transcript variant 2 |
CN¥ 4,840.00 |
|
PH321625 | CRAT MS Standard C13 and N15-labeled recombinant protein (NP_003994) |
CN¥ 14,250.00 |
|
TP760585 | Purified recombinant protein of Human carnitine O-acetyltransferase (CRAT), nuclear gene encoding mitochondrial protein, transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |