CD133 (PROM1) (NM_006017) Human Recombinant Protein
CAT#: TP321611
Recombinant protein of human prominin 1 (PROM1), transcript variant 1, 20 µg
View other "CD133" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 1,999.00
CNY 3,600.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221611 representing NM_006017
Red=Cloning site Green=Tags(s) MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRD FPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCG GEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPE QIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSL HQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLR TDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLS FLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVY SDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMN YDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVK ILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKP VATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME NGNNGYHKDHVYGIHNPVMTSPSQH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 97 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006008 |
Locus ID | 8842 |
UniProt ID | O43490 |
Refseq Size | 3794 |
Cytogenetics | 4p15.32 |
Refseq ORF | 2595 |
Synonyms | AC133; CD133; CORD12; MCDR2; MSTP061; PROML1; RP41; STGD4 |
Summary | This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Functional links between gelatinase B/matrix metalloproteinase-9 and prominin-1/CD133 in diabetic retinal vasculopathy and neuropathy
,Mohammad, G;Vandooren, J;Siddiquei, MM;Martens, E;Abu El-Asrar, AM;Opdenakker, G;,
Prog Retin Eye Res July 2014
,PubMed ID 25080402
[PROM1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416886 | PROM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429028 | PROM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416886 | Transient overexpression lysate of prominin 1 (PROM1), transcript variant 1 |
CNY 4,840.00 |
|
LY429028 | Transient overexpression lysate of prominin 1 (PROM1), transcript variant 2 |
CNY 4,840.00 |
|
PH321611 | PROM1 MS Standard C13 and N15-labeled recombinant protein (NP_006008) |
CNY 19,520.00 |
|
PH327854 | PROM1 MS Standard C13 and N15-labeled recombinant protein (NP_001139319) |
CNY 14,250.00 |
|
TP327854 | Recombinant protein of human prominin 1 (PROM1), transcript variant 2, 20 µg |
CNY 2,900.00 |