ARMET (MANF) (NM_006010) Human Recombinant Protein
CAT#: TP321555
Recombinant protein of human arginine-rich, mutated in early stage tumors (ARMET), 20 µg
View other "ARMET" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221555 representing NM_006010
Red=Cloning site Green=Tags(s) MRRMRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREA RGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRV KELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006001 |
Locus ID | 7873 |
UniProt ID | P55145, A8K878 |
Refseq Size | 993 |
Cytogenetics | 3p21.2 |
Refseq ORF | 555 |
Synonyms | ARMET; ARP |
Summary | The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401818 | MANF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401818 | Transient overexpression lysate of mesencephalic astrocyte-derived neurotrophic factor (MANF) |
CNY 3,080.00 |
|
PH321555 | MANF MS Standard C13 and N15-labeled recombinant protein (NP_006001) |
CNY 19,520.00 |
|
TP721225 | Purified recombinant protein of Human mesencephalic astrocyte-derived neurotrophic factor (MANF) |
CNY 3,140.00 |