MAFG (NM_002359) Human Recombinant Protein
CAT#: TP321486
Recombinant protein of human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, 20 µg
View other "MAFG" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221486 representing NM_002359
Red=Cloning site Green=Tags(s) MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL VPGKVAATSVITIVKSKTDARS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002350 |
Locus ID | 4097 |
UniProt ID | O15525 |
Refseq Size | 5043 |
Cytogenetics | 17q25.3 |
Refseq ORF | 486 |
Synonyms | hMAF |
Summary | Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein (MafF, MIM 604877; MafG; or MafK, MIM 600197) and the tissue-restricted protein p45 NFE2 (MIM 601490). Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160).[supplied by OMIM, Mar 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409976 | MAFG HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC419371 | MAFG HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY409976 | Transient overexpression lysate of v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 2 |
CN¥ 3,080.00 |
|
LY419371 | Transient overexpression lysate of v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 |
CN¥ 3,080.00 |
|
PH321486 | MAFG MS Standard C13 and N15-labeled recombinant protein (NP_002350) |
CN¥ 19,520.00 |