TIGIT (NM_173799) Human Recombinant Protein
CAT#: TP321447
Recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), 20 µg
View other "TIGIT" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221447 protein sequence
Red=Cloning site Green=Tags(s) MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776160 |
Locus ID | 201633 |
UniProt ID | Q495A1 |
Refseq Size | 2978 |
Cytogenetics | 3q13.31 |
Refseq ORF | 732 |
Synonyms | VSIG9; VSTM3; WUCAM |
Summary | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.[provided by RefSeq, Sep 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406575 | TIGIT HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY406575 | Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) |
CN¥ 3,080.00 |
|
PH321447 | TIGIT MS Standard C13 and N15-labeled recombinant protein (NP_776160) |
CN¥ 19,520.00 |
|
TP700214 | Purified recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CN¥ 6,650.00 |
|
TP723994 | Human TIGIT Protein, hFc Tag |
CN¥ 5,400.00 |
|
TP724032 | Human TIGIT Protein, mFc Tag |
CN¥ 4,925.00 |
|
TP724033 | Human TIGIT Protein, His Tag |
CN¥ 4,925.00 |