BCL2L12 (NM_138639) Human Recombinant Protein
CAT#: TP321347
Recombinant protein of human BCL2-like 12 (proline rich) (BCL2L12), transcript variant 1, 20 µg
View other "BCL2L12" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221347 representing NM_138639
Red=Cloning site Green=Tags(s) MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQV EWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPC SLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAIL RRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARL ALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619580 |
Locus ID | 83596 |
UniProt ID | Q9HB09 |
Refseq Size | 1893 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1002 |
Summary | This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403365 | BCL2L12 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC420742 | BCL2L12 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403365 | Transient overexpression lysate of BCL2-like 12 (proline rich) (BCL2L12), transcript variant 1 |
CN¥ 3,080.00 |
|
LY420742 | Transient overexpression lysate of BCL2-like 12 (proline rich) (BCL2L12), transcript variant 3 |
CN¥ 3,080.00 |
|
PH321347 | BCL2L12 MS Standard C13 and N15-labeled recombinant protein (NP_619580) |
CN¥ 19,520.00 |
其它BCL2L12产品