LIPF (NM_004190) Human Recombinant Protein
CAT#: TP321225
Recombinant protein of human lipase, gastric (LIPF), 20 µg
View other "LIPF" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221225 representing NM_004190
Red=Cloning site Green=Tags(s) MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004181 |
Locus ID | 8513 |
UniProt ID | P07098 |
Refseq Size | 1365 |
Cytogenetics | 10q23.31 |
Refseq ORF | 1194 |
Synonyms | GL; HGL; HLAL |
Summary | This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401348 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434185 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434194 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434213 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401348 | Transient overexpression lysate of lipase, gastric (LIPF) |
CNY 3,080.00 |
|
LY434185 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 3 |
CNY 3,080.00 |
|
LY434194 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 4 |
CNY 3,080.00 |
|
LY434213 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 1 |
CNY 3,080.00 |
|
PH321225 | LIPF MS Standard C13 and N15-labeled recombinant protein (NP_004181) |
CNY 19,520.00 |
|
TP721035 | Purified recombinant protein of Human lipase, gastric (LIPF), transcript variant 2 |
CNY 1,800.00 |