NICE2 (S100A7A) (NM_176823) Human Recombinant Protein
CAT#: TP321177
Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 20 µg
View other "NICE2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221177 representing NM_176823
Red=Cloning site Green=Tags(s) MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789793 |
Locus ID | 338324 |
UniProt ID | Q86SG5 |
Refseq Size | 4351 |
Cytogenetics | 1q21.3 |
Refseq ORF | 303 |
Synonyms | NICE-2; NICE2; S100A7f; S100A7L1; S100A15 |
Summary | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406111 | S100A7A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406111 | Transient overexpression lysate of S100 calcium binding protein A7A (S100A7A) |
CNY 3,080.00 |
|
PH321177 | S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793) |
CNY 19,520.00 |