NICE2 (S100A7A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-S100A7A antibody is: synthetic peptide directed towards the middle region of Human S100A7A. Synthetic peptide located within the following region: CDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	S100 calcium binding protein A7A
Database Link	NP_789793 Entrez Gene 338324 Human UniProt ID Q86SG5
Background	S100A7A may be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
Synonyms	NICE-2; S100A7f; S100A7L1; S100A15
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Goat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.