CNN2 (NM_004368) Human Recombinant Protein
CAT#: TP321104
Recombinant protein of human calponin 2 (CNN2), transcript variant 1, 20 µg
View other "CNN2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221104 representing NM_004368
Red=Cloning site Green=Tags(s) MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA DGAPSGTGDCPDPGEVPEYPPYYQEEAGY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004359 |
Locus ID | 1265 |
UniProt ID | Q99439 |
Refseq Size | 2478 |
Cytogenetics | 19p13.3 |
Refseq ORF | 927 |
Summary | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Calponin-h2: a potential serum marker for the early detection of human breast cancer?
,Debald, M;Jin, JP;Linke, A;Walgenbach, KJ;Rauch, P;Zellmer, A;Fimmers, R;Kuhn, W;Hartmann, G;Walgenbach-Brünagel, G;,
Tumour Biol.
,PubMed ID 25099617
[CNN2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404509 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418024 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404509 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 2 |
CNY 3,080.00 |
|
LY418024 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 1 |
CNY 3,080.00 |
|
PH312208 | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_958434) |
CNY 14,250.00 |
|
PH321104 | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359) |
CNY 19,520.00 |
|
TP312208 | Purified recombinant protein of Homo sapiens calponin 2 (CNN2), transcript variant 2, 20 µg |
CNY 2,900.00 |