CNN2 (NM_004368) Human Mass Spec Standard
CAT#: PH321104
CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359)
View other "CNN2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221104 |
Predicted MW | 33.5 kDa |
Protein Sequence |
>RC221104 representing NM_004368
Red=Cloning site Green=Tags(s) MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA DGAPSGTGDCPDPGEVPEYPPYYQEEAGY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004359 |
RefSeq Size | 2478 |
RefSeq ORF | 927 |
Locus ID | 1265 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404509 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418024 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404509 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 2 |
CNY 3,080.00 |
|
LY418024 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 1 |
CNY 3,080.00 |
|
PH312208 | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_958434) |
CNY 14,250.00 |
|
TP312208 | Purified recombinant protein of Homo sapiens calponin 2 (CNN2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321104 | Recombinant protein of human calponin 2 (CNN2), transcript variant 1, 20 µg |
CNY 2,900.00 |