CPNE1 (NM_152929) Human Recombinant Protein
CAT#: TP321043
Recombinant protein of human copine I (CPNE1), transcript variant 6, 20 µg
View other "CPNE1" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221043 protein sequence
Red=Cloning site Green=Tags(s) MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690906 |
Locus ID | 8904 |
UniProt ID | Q99829 |
Refseq Size | 2199 |
Cytogenetics | 20q11.22 |
Refseq ORF | 1611 |
Synonyms | copine-1; copine I; COPN1; CPN1; MGC1142; OTTHUMP00000030775; OTTHUMP00000030776 |
Summary | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Aug 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407221 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407223 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407224 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407221 | Transient overexpression lysate of copine I (CPNE1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY407223 | Transient overexpression lysate of copine I (CPNE1), transcript variant 5 |
CN¥ 3,080.00 |
|
LY407224 | Transient overexpression lysate of copine I (CPNE1), transcript variant 6 |
CN¥ 3,080.00 |
|
PH312736 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690905) |
CN¥ 14,250.00 |
|
PH312892 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690902) |
CN¥ 14,250.00 |
|
PH321043 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690906) |
CN¥ 19,520.00 |
|
PH321253 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903) |
CN¥ 14,250.00 |
|
PH323828 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690904) |
CN¥ 14,250.00 |
|
TP312736 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 5, 20 µg |
CN¥ 2,900.00 |
|
TP312892 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP321253 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP323828 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP721021 | Purified recombinant protein of Human copine I (CPNE1), transcript variant 5 |
CN¥ 1,800.00 |