Nogo A (RTN4) (NM_207520) Human Recombinant Protein
CAT#: TP320981
Recombinant protein of human reticulon 4 (RTN4), transcript variant 4, 20 µg
View other "Nogo A" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220981 representing NM_207520
Red=Cloning site Green=Tags(s) MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPT APAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPP ARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAVVDLLY WRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFS VPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997403 |
Locus ID | 57142 |
UniProt ID | Q9NQC3 |
Refseq Size | 2471 |
Cytogenetics | 2p16.1 |
Refseq ORF | 1176 |
Synonyms | ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C |
Summary | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402073 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403920 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412411 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429630 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402073 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 3 |
CNY 3,080.00 |
|
LY403920 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 4 |
CNY 3,080.00 |
|
LY412411 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
CNY 4,840.00 |
|
LY429630 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
CNY 4,840.00 |
|
PH320981 | RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_997403) |
CNY 19,520.00 |
|
PH321080 | RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_008939) |
CNY 19,520.00 |
|
TP321080 | Recombinant protein of human reticulon 4 (RTN4), transcript variant 3, 20 µg |
CNY 2,900.00 |