PRKACA (NM_207518) Human Recombinant Protein
CAT#: TP320877
Recombinant protein of human protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2, 20 µg
View other "PRKACA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220877 representing NM_207518
Red=Cloning site Green=Tags(s) MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQ KVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYA AQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNK AVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNG VNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997401 |
Locus ID | 5566 |
UniProt ID | P17612, A8K8B9 |
Refseq Size | 2490 |
Cytogenetics | 19p13.12 |
Refseq ORF | 1029 |
Synonyms | CAFD1; PKACA; PPNAD4 |
Summary | This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403918 | PRKACA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419140 | PRKACA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403918 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2 |
CNY 3,080.00 |
|
LY419140 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1 |
CNY 3,080.00 |
|
PH310332 | PRKACA MS Standard C13 and N15-labeled recombinant protein (NP_002721) |
CNY 19,520.00 |
|
PH320877 | PRKACA MS Standard C13 and N15-labeled recombinant protein (NP_997401) |
CNY 19,520.00 |
|
TP310332 | Recombinant protein of human protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, 20 µg |
CNY 2,900.00 |