p73 (TP73) (NM_005427) Human Recombinant Protein
CAT#: TP320864
Recombinant protein of human tumor protein p73 (TP73), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220864 representing NM_005427
Red=Cloning site Green=Tags(s) MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSS TMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSA TWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAP ASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMR DGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHG DEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPPPYHAD PSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQL LRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEF TEAEIH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005418 |
Locus ID | 7161 |
UniProt ID | O15350, A1PQX5 |
Refseq Size | 2234 |
Cytogenetics | 1p36.32 |
Refseq ORF | 1908 |
Synonyms | P73 |
Summary | This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Neurotrophin signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417321 | TP73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426670 | TP73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417321 | Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 1 |
CNY 4,840.00 |
|
LY426670 | Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 4 |
CNY 3,080.00 |
|
PH320864 | TP73 MS Standard C13 and N15-labeled recombinant protein (NP_005418) |
CNY 19,520.00 |
|
PH325696 | TP73 MS Standard C13 and N15-labeled recombinant protein (NP_001119714) |
CNY 14,250.00 |
|
TP325696 | Purified recombinant protein of Homo sapiens tumor protein p73 (TP73), transcript variant 4, 20 µg |
CNY 2,900.00 |