RFXANK (NM_003721) Human Recombinant Protein
CAT#: TP320744
Recombinant protein of human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, 20 µg
View other "RFXANK" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220744 protein sequence
Red=Cloning site Green=Tags(s) MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHS TTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETV RFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALL ARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003712 |
Locus ID | 8625 |
UniProt ID | O14593 |
Refseq Size | 1455 |
Cytogenetics | 19p13.11 |
Refseq ORF | 780 |
Synonyms | ANKRA1; BLS; F14150_1; RFX-B |
Summary | Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Antigen processing and presentation, Primary immunodeficiency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408725 | RFXANK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418474 | RFXANK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408725 | Transient overexpression lysate of regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 2 |
CNY 3,080.00 |
|
LY418474 | Transient overexpression lysate of regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1 |
CNY 3,080.00 |
|
PH320744 | RFXANK MS Standard C13 and N15-labeled recombinant protein (NP_003712) |
CNY 19,520.00 |