INPP5F (OCRL) (NM_000276) Human Recombinant Protein
CAT#: TP320672
Recombinant protein of human oculocerebrorenal syndrome of Lowe (OCRL), transcript variant a, 20 µg
View other "INPP5F" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220672 representing NM_000276
Red=Cloning site Green=Tags(s) MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEE TLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKD KPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLF VPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELD LSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMG KMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWL GDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSG KCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMEND FLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETV DISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVT KLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIID CLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLM AFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 104 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (PMID: 29524543) |
Reference Data | |
RefSeq | NP_000267 |
Locus ID | 4952 |
UniProt ID | Q01968 |
Refseq Size | 5165 |
Cytogenetics | Xq26.1 |
Refseq ORF | 2703 |
Synonyms | Dent-2; DENT2; INPP5F; LOCR; NPHL2; OCRL-1; OCRL1 |
Summary | This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A phosphoglycolate phosphatase/AUM-dependent link between triacylglycerol turnover and epidermal growth factor signaling
,Segerer, G;Engelmann, D;Kaestner, A;Trötzmüller, M;Köfeler, H;Stigloher, C;Thiele, C;Jeanclos, E;Gohla, A;,
Biochim. Biophys. Acta
,PubMed ID 29524543
[OCRL]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400105 | OCRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC419853 | OCRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400105 | Transient overexpression lysate of oculocerebrorenal syndrome of Lowe (OCRL), transcript variant a |
CNY 4,840.00 |
|
LY419853 | Transient overexpression lysate of oculocerebrorenal syndrome of Lowe (OCRL), transcript variant b |
CNY 3,080.00 |
|
PH310491 | OCRL MS Standard C13 and N15-labeled recombinant protein (NP_001578) |
CNY 19,520.00 |
|
PH320672 | OCRL MS Standard C13 and N15-labeled recombinant protein (NP_000267) |
CNY 19,520.00 |
|
TP310491 | Recombinant protein of human oculocerebrorenal syndrome of Lowe (OCRL), transcript variant b, 20 µg |
CNY 2,900.00 |