RIT1 (NM_006912) Human Recombinant Protein
CAT#: TP320552
Recombinant protein of human Ras-like without CAAX 1 (RIT1), 20 µg
View other "RIT1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220552 protein sequence
Red=Cloning site Green=Tags(s) MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPAN LDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQ LRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSP FRKKKDSVT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008843 |
Locus ID | 6016 |
UniProt ID | Q92963 |
Refseq Size | 3455 |
Cytogenetics | 1q22 |
Refseq ORF | 657 |
Synonyms | NS8; RIBB; RIT; ROC1 |
Summary | This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416316 | RIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416316 | Transient overexpression lysate of Ras-like without CAAX 1 (RIT1) |
CN¥ 3,080.00 |
|
PH320552 | RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843) |
CN¥ 19,520.00 |