COQ7 (NM_016138) Human Recombinant Protein
CAT#: TP320317
Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), 20 µg
View other "COQ7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220317 representing NM_016138
Red=Cloning site Green=Tags(s) MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA IYLSERL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057222 |
Locus ID | 10229 |
UniProt ID | Q99807 |
Refseq Size | 2591 |
Cytogenetics | 16p12.3 |
Refseq ORF | 651 |
Synonyms | CAT5; CLK-1; CLK1; COQ10D8 |
Summary | The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414165 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433767 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414165 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) |
CNY 3,080.00 |
|
LY433767 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 2 |
CNY 3,080.00 |
|
PH320317 | COQ7 MS Standard C13 and N15-labeled recombinant protein (NP_057222) |
CNY 19,520.00 |