PML Protein (PML) (NM_033244) Human Recombinant Protein
CAT#: TP320236
Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5, 20 µg
View other "PML Protein" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220236 representing NM_033244
Red=Cloning site Green=Tags(s) MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGRERNALW SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 61.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_150247 |
Locus ID | 5371 |
UniProt ID | P29590 |
Refseq Size | 3096 |
Cytogenetics | 15q24.1 |
Refseq ORF | 1680 |
Synonyms | MYL; PP8675; RNF71; TRIM19 |
Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409649 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC409651 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC409652 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC409653 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC409655 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409649 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 |
CNY 4,840.00 |
|
LY409651 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 |
CNY 4,840.00 |
|
LY409652 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 |
CNY 4,840.00 |
|
LY409653 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 |
CNY 4,840.00 |
|
LY409655 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 |
CNY 3,080.00 |
|
PH312067 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) |
CNY 19,520.00 |
|
PH320236 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150247) |
CNY 14,250.00 |
|
PH320522 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150249) |
CNY 14,250.00 |
|
TP312067 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9, 20 µg |
CNY 2,900.00 |
|
TP320522 | Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7, 20 µg |
CNY 2,900.00 |
其它PML Protein产品