Ephrin A4 (EFNA4) (NM_182690) Human Recombinant Protein
CAT#: TP320109
Recombinant protein of human ephrin-A4 (EFNA4), transcript variant 3, 20 µg
View other "Ephrin A4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220109 representing NM_182690
Red=Cloning site Green=Tags(s) MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES SGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872632 |
Locus ID | 1945 |
UniProt ID | P52798 |
Refseq Size | 1111 |
Cytogenetics | 1q21.3 |
Refseq ORF | 579 |
Synonyms | EFL4; EPLG4; LERK4 |
Summary | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405453 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417433 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405453 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 3 |
CNY 3,080.00 |
|
LY417433 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 1 |
CNY 3,080.00 |
|
PH320109 | EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632) |
CNY 19,520.00 |
其它Ephrin A4产品