TCF21 (NM_198392) Human Recombinant Protein
CAT#: TP320002
Recombinant protein of human transcription factor 21 (TCF21), transcript variant 1, 20 µg
View other "TCF21" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220002 representing NM_198392
Red=Cloning site Green=Tags(s) MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_938206 |
Locus ID | 6943 |
UniProt ID | O43680 |
Refseq Size | 3231 |
Cytogenetics | 6q23.2 |
Refseq ORF | 537 |
Synonyms | bHLHa23; POD1 |
Summary | TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405044 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418825 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405044 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 1 |
CN¥ 3,080.00 |
|
LY418825 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 2 |
CN¥ 3,080.00 |
|
PH320002 | TCF21 MS Standard C13 and N15-labeled recombinant protein (NP_938206) |
CN¥ 19,520.00 |
|
TP761400 | Purified recombinant protein of Human transcription factor 21 (TCF21), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CN¥ 2,040.00 |