CXorf27 (HYPM) (NM_012274) Human Recombinant Protein
CAT#: TP319889
Recombinant protein of human chromosome X open reading frame 27 (CXorf27), 20 µg
View other "CXorf27" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219889 representing NM_012274
Red=Cloning site Green=Tags(s) MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGL EASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036406 |
Locus ID | 25763 |
UniProt ID | O75409 |
Refseq Size | 517 |
Cytogenetics | Xp11.4 |
Refseq ORF | 351 |
Synonyms | CXorf27; HIP17; HYPM |
Summary | This gene encodes a protein shown to interact with huntingtin, which contains an expanded polyglutamine tract in individuals with Huntington's disease (PMID: 9700202). [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415843 | HYPM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415843 | Transient overexpression lysate of chromosome X open reading frame 27 (CXorf27) |
CNY 3,080.00 |
|
PH319889 | CXorf27 MS Standard C13 and N15-labeled recombinant protein (NP_036406) |
CNY 19,520.00 |
其它CXorf27产品